ELISA Recombinant Serratia proteamaculans Na(+)-translocating NADH-quinone reductase subunit E
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Serratia proteamacµLans (strain 568)
Uniprot NO.:A8GAC3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEHYISLFVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTLVLGISVPVNNLVY NLILRDGALVEGVDLSFLNFITFIGVIAALVQILEMILDRFFPSLYNALGIFLPLITVNC AIFGGVSFMVQRDYNFAESVVYGFGSGTGWmLAIVAMAGIREKLKYANVPAGLRGLGITF ITTGLMALGFMSFSGVQL
Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit E Short name= Na(+)-NQR subunit E Short name= Na(+)-translocating NQR subunit E EC= 1.6.5.- Alternative name(s): NQR complex subunit E NQR-1 subunit E
Gene Names:Name:nqrE Ordered Locus Names:Spro_0957
Expression Region:1-198
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.