ELISA Recombinant Rickettsia bellii Putative Na(+)-H(+) antiporter nhaA homolog

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rickettsia bellii (strain OSU 85-389) Uniprot NO.:A8GYC5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVEAGIHGTLCGAIIALFIPVNIKGQINSSFHKLEKLIQPFVNYFILPLFVFMNSGVLLK DFSFRSVCSSLTFGIILGLFIGKQLGVmLFSYPCVKFNFCSLPSNTSWLKFYSIAILGGI GFTLSLFIGGITFEGGCPSNSMRVAVIIGSLLSALFGILVMRYCTKSK Protein Names:Recommended name: Putative Na(+)/H(+) antiporter nhaA homolog Gene Names:Name:nhaA Ordered Locus Names:A1I_07885 Expression Region:1-168 Sequence Info:fµLl length protein