ELISA Recombinant Shewanella pealeana Electron transport complex protein RnfA(rnfA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) Uniprot NO.:A8H536 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSEYLLLLIGTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVN QYLLLPFDLGYLRTMSFILVIAVVVQFTEmLVQKTSASLHRALGIYLPLITTNCAVLGVA LLNINEKHGFIESAIFGFGAAVGFSLVLILFSAMRERLAAADVPTPFKGGAIAMVTAGLM SLAFMGFTGLVK Protein Names:Recommended name: Electron transport complex protein RnfA Gene Names:Name:rnfA Ordered Locus Names:Spea_2353 Expression Region:1-192 Sequence Info:fµLl length protein