ELISA Recombinant Salmonella arizonae L-alanine exporter AlaE(alaE)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) Uniprot NO.:A9MG10 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFSPQSRLRHAVADTFAMVVYCSVVNmLIEIFLSGMSVEQSLSSRLVAIPVNILIAWPYG VYRDLIMRVARKASPAGWAKNLADVLAYVTFQSPVYIIILLTVGADWHQIMAAVSSNIVV SmLMGAVYGYFLDYCRRLFKVSNYHQAKA Protein Names:Recommended name: L-alanine exporter AlaE Gene Names:Name:alaE Ordered Locus Names:SARI_00171 Expression Region:1-149 Sequence Info:fµLl length protein