ELISA Recombinant Salmonella arizonae Nickel-cobalt efflux system rcnA(rcnA)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Uniprot NO.:A9MRK2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGEFSILLQQGNGWFFIPSAILLGILHGLEPGHSKTMMAAFIIAIKGTIKQAFmLGLAAT LSHTAVVWLIALGGMYLSRAYAAESVEPWLQLISAIIILGTACWMFWRTWRGEQQWLTGS HHDHDHDHDHDHDHDHDHDHDHDHHGHTYPEGAMSKAYQDAHERAHAADIQRRFHGQKVT NEQILLFGLTGGLIPCPAAITLLLICIQLQALTLGATMVLCFSLGLALTLVAVGVGAAIS VQQAVKRWNGFTTLARRAPYFSSILIGLVGLYMGIHGYTGIMQ
Protein Names:Recommended name: Nickel/cobalt efflux system rcnA
Gene Names:Name:rcnA Ordered Locus Names:SARI_04629
Expression Region:1-283
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.