ELISA Recombinant Yersinia pestis bv. Antiqua UPF0761 membrane protein YpAngola_A0034 (YpAngola_A0034)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Yersinia pestis bv. Antiqua (strain Angola)
Uniprot NO.:A9R654
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASFRRFRLLSPLKPCVTFGRmLYTRIDKDGLTmLAGHLAYVSLLSLVPLITVIFALFAA FPMFAEISIKLKAFIFANFMPATGDIIQNYLEQFVANSNRMTVVGTCGLIVTALLLIYSV DSVLNIIWRSKIQRSLVFSFAVYWMVLTLGPILVGASMVISSYLLSLHWLAHARVDSMID EILRVFPLLISWVSFWLLYSVVPTVRVPARDALIGALVAALLFELGKKGFAMYITLFPSY QLIYGVLAVIPILFLWVYWSWCIVLLGAEITVTLGEYRAERHHAKSVTTQSPEM
Protein Names:Recommended name: UPF0761 membrane protein YpAngola_A0034
Gene Names:Ordered Locus Names:YpAngola_A0034
Expression Region:1-294
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.