ELISA Recombinant Sorangium cellulosum UPF0059 membrane protein sce0548 (sce0548)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Sorangium cellµLosum (strain So ce56) (Polyangium cellµLosum (strain So ce56)) Uniprot NO.:A9GV45 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNFSAILLLALGLAMDATAVAAARGLSVPAIRARHVLLVAGFFGGAQALMPVIGWLLGAR IGPRVQAWDHWIAFVLLAFIGGKmLWEARGDGGDDGGEGETTADPFALSAMFVLAIATSI DALAVGITLPmLNAPFAISVVTIGVVTALLSAAGLFAGRRFGALLGKRLDLAGGVVLIGL GFKILLEHLVLS Protein Names:Recommended name: UPF0059 membrane protein sce0548 Gene Names:Ordered Locus Names:sce0548 Expression Region:1-192 Sequence Info:fµLl length protein