ELISA Recombinant Chloroflexus aurantiacus Sec-independent protein translocase protein TatA(tatA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) Uniprot NO.:A9WK61 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIGGLGWGELLIILIIVIAIFGAGKLAGLGGALGSSIREFRKAVKGDDEPRSDAKTEGET KV Protein Names:Recommended name: Sec-independent protein translocase protein TatA Gene Names:Name:tatA Ordered Locus Names:Caur_1284 Expression Region:1-62 Sequence Info:fµLl length protein