ELISA Recombinant Salmonella arizonae UPF0299 membrane protein yohJ(yohJ)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) Uniprot NO.:A9MKS7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSKSLNIIWQYIRAFVLIYACLYAGIFIASLLPITIPGSIIGmLILFVLLALQILPAKWV NPGCYVLIRYMALLFVPIGVGVMQYFDLLRAQFGPVVVSCAISTLVVFVVVSWSSHLIHG ERNVVGQKGSKK Protein Names:Recommended name: UPF0299 membrane protein yohJ Gene Names:Name:yohJ Ordered Locus Names:SARI_00720 Expression Region:1-132 Sequence Info:fµLl length protein