ELISA Recombinant Podospora anserina 3-ketoacyl-CoA reductase (Pa_6_6580)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina) Uniprot NO.:B2B3L4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASQIAQLLEKALHFWNAVPQPLQYTFAALGALYVLRGALSFVRLLLNSFILSGPNLRKY GKKGTWAVVTGASDGLGKEFASQLASKGFNLVLVSRTQSKLDALAKELRLKWSGLETKVL AMDFSQDNDEDYERLAKLIAGLDVGILINNVGQSHSIPVSFLDTEKTELQSIVTINCLGT LKTTKVVAPILAARKKGLILTMGSFAGTMPTPYLATYSGSKAFLQHWSSSLASELAPHGV DVQFVISYLVTTAMSKVRRTSLLIPGPKQFVKAALGKIGLDSNENFPNTYTPWWSHNVFK WIIDSTVGNTSAFTIWQNRKMHVDIRNRALRKAAREAKKQ Protein Names:Recommended name: 3-ketoacyl-CoA reductase Short name= 3-ketoreductase Short name= KAR EC= 1.1.1.- Alternative name(s): Microsomal beta-keto-reductase Gene Names:ORF Names:Pa_6_6580 Expression Region:1-340 Sequence Info:fµLl length protein