ELISA Recombinant Ralstonia pickettii NADH-quinone oxidoreductase subunit A(nuoA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ralstonia pickettii (strain 12J) Uniprot NO.:B2U7R1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNLEAYFPVLLFIVVGVGLGLALMTIGRVLGPNNPDPDKLSPYECGFEAFEDARMKFDVR YYLIAILFILFDLETAFLFPWGVALREIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1 Gene Names:Name:nuoA Ordered Locus Names:Rpic_2214 Expression Region:1-119 Sequence Info:fµLl length protein