ELISA Recombinant Pyrenophora tritici-repentis Signal peptidase complex catalytic subunit sec11(sec11)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis) Uniprot NO.:B2WEL2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLGIADMQPRQLAAQILNFALVLSTAFMMWKGLSVVSDSPSPIVVVLSGSMEPAFQRGDL LFLWNRGADTQVGEIVVYNVKGKDIPIVHRVVRRYGGGKTPLRLLTKGDNNLADDTELYA AGQSFLNRQEDVIGSVVGFIPFVGYVTILLSEHPWLKQVmLGLMGVMVVLQRE Protein Names:Recommended name: Signal peptidase complex catalytic subunit sec11 EC= 3.4.21.89 Alternative name(s): Signal peptidase I Gene Names:Name:sec11 ORF Names:PTRG_08585 Expression Region:1-173 Sequence Info:fµLl length protein