ELISA Recombinant Yersinia pseudotuberculosis serotype IB Lipoprotein signal peptidase(lspA)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pseudotubercµLosis serotype IB (strain PB1/+)
Uniprot NO.:B2K3M7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNKPICSTGLRWLWLAVVVVILDISSKQWVMAHFALYESVPLIPFFNLTYAQNFGAAFSF LADKSGWQRWFFAGIAIGISVVLMVMMYRSTAKQRLINCAYALIIGGALGNLYDRLVHGA VNDFLDFYINNWHFPTFNLADVAICIGAALVIFEGFLSPVEKNAVNNDE
Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II
Gene Names:Name:lspA Ordered Locus Names:YPTS_0642
Expression Region:1-169
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.