ELISA Recombinant Shigella boydii serotype 18 Undecaprenyl-diphosphatase(uppP)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) Uniprot NO.:B2U1G1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQHEGESKGRLTLIHILLGMIPAVVLGLLFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGmLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTTGDIPMFAVGFITAFVVALI AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF Protein Names:Recommended name: Undecaprenyl-diphosphatase EC= 3.6.1.27 Alternative name(s): Bacitracin resistance protein Undecaprenyl pyrophosphate phosphatase Gene Names:Name:uppP Ordered Locus Names:SbBS512_E3488 Expression Region:1-273 Sequence Info:fµLl length protein