ELISA Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 34, mitochondrial(AIM34)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast) Uniprot NO.:B3LLQ4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:HLSFLMNNNDITPFQKFTVKVLKEQCKSRGLKLSGRKSDLLQRLITHDSCSNKKSSVKIN EPKKKRILINDPIKITKKLVSDKTFRTIEKNISSLQNTPVIETPCDVHSHLQPRDRIFLL GFFmLSCLWWNLEPQESKPTIDH Protein Names:Recommended name: Altered inheritance of mitochondria protein 34, mitochondrial Gene Names:Name:AIM34 ORF Names:SCRG_01898 Expression Region:56-198 Sequence Info:fµLl length protein