ELISA Recombinant Podospora anserina High osmolarity signaling protein SHO1(SHO1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina) Uniprot NO.:B2ANF9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPNYGSLHSPSLRKMEQSRIQYGRKRLSLGNIIGDPFALATISIAFLAWIISFFGSLFAH INQPPNTPGVNNSFPLYTWWAVVFYFFLVVGVFIVVASDSVQTYHVAIVGYLGCGLVLST SAVHGLIYSNIGSREAAAAGMILLAMVTIVWIFYFGSAPSAVPRAYIDSFALAKESSTNR QTMNTGYGIGRPETSTSVQPPQMYTAQLNGLENPSPVGGMQSSGMRNSAVPPPFQSTLGQ KSNGLPGSSDGDIAPPTEYPYRAKAIYSYEANPEDANEISFQKHEILEVSDVSGRWWQAR KENGDTGIAPSNYLILL Protein Names:Recommended name: High osmolarity signaling protein SHO1 Alternative name(s): Osmosensor SHO1 Gene Names:Name:SHO1 ORF Names:CDS Pa_6_10750 Expression Region:1-317 Sequence Info:fµLl length protein