Skip to Content

ELISA Recombinant Stenotrophomonas maltophilia UPF0761 membrane protein Smlt0865 (Smlt0865)

https://www.anagnostics.com/web/image/product.template/158926/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Stenotrophomonas maltophilia (strain K279a) Uniprot NO.:B2FQ10 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEPLDTLNLWMERARDRARAISFGRFLWHRFLDDRLFQAAAALAYTTVFALVPLAIVVFG VLSAFPVFDRWSDQLSDYVFSNFVPNAARAAEGYLRQFSASAGQLTAAGFIALVVSLLIT LNSVEETFNQIWRVGSTRPKLTRFLVYWTVLTLGAmLAAASLAVSARVFAMPLFGTQEGR WLAELALRLAPILIEFVCITLMFRVVPHHTVKWRHAVPGAILAAVILELVKWGIGAYLGS FQSYQKLYGTVAFVPILLLWIYLCWVAVLLGASLSSSMAAFRYQPVELRLPQGYEFYGLL RLLGRFHHARAKGKGLADDEILRLEPmLTDSLLQDLACNLQEIGLLRRDERGEWLLSRDL DQVSLADLYECTQLRIPVAEQHLPYRDDSLGRAALAALDDLRLPLRERLKRKVSDIYTDS GDMP Protein Names:Recommended name: UPF0761 membrane protein SmLt0865 Gene Names:Ordered Locus Names:SmLt0865 Expression Region:1-424 Sequence Info:fµLl length protein

1,783.00 € 1783.0 EUR 1,783.00 €

1,783.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.