ELISA Recombinant Pyrenophora tritici-repentis Solute carrier family 25 member 38 homolog (PTRG_00728)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis) Uniprot NO.:B2VSU4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSDGGKSSSSYFHFFAGLNSGILSAVLLQPADLLKTRVQQSRSSTLFGTIQSIASGPNPV RQFWRGTLPSTLRTGFGSAIYFSSLNALRHRASLGAAGRADAAAKGAEHSSSLPKLSNTA NLATGAFARTWAGFIMMPITVLKVRYESNLYAYNSLFTASRDIFRTEGLKGFFAGFGATA VRDAPYAGLYVLFYEQSKRKLSSLATKIEQTSGASTKLSTSTSAGINFVSGVAAAGLGTT ITNPFDAIKTRIQLMPERYGNMVQATKKMYMEEGLRCFFDGLGIRIARKAVSSALAWTLY EELIRRAETLKEVVEDKI Protein Names:Recommended name: Solute carrier family 25 member 38 homolog Gene Names:ORF Names:PTRG_00728 Expression Region:1-318 Sequence Info:fµLl length protein