ELISA Recombinant Sulfurihydrogenibium sp. Protein CrcB homolog(crcB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:SµLfurihydrogenibium sp. (strain YO3AOP1) Uniprot NO.:B2V9L9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEKYLVIAVGGSIGAILRYLTGVYSAKFFGTWLPYGTLIVNVVGSFILSFFMILFLEKLS LDPLWRLFVAVGFCGSYTTLSSITYETLSIVMDGDYVRALLNIALNFGLSFLSAFAGIVL ARmL Protein Names:Recommended name: Protein CrcB homolog Gene Names:Name:crcB Ordered Locus Names:SYO3AOP1_1023 Expression Region:1-124 Sequence Info:fµLl length protein