Skip to Content

ELISA Recombinant Podospora anserina Golgi apparatus membrane protein TVP38(TVP38)

https://www.anagnostics.com/web/image/product.template/149878/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina) Uniprot NO.:B2AMJ3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGPDEIEMVPPKTPRGLPPSETDYQPVNWKRLFLRPKYLAMWVVLVIIIILTAIITIYHD KVVEVGDIRHFDNVCGGKQEILTAHPLQHLRPFAEQVRHLPGGWLIPIVILIVISFPPLF GHEIIALLCGVVYGLWIGFGIVAAGTFLGEVGTWFAFKYLFRQKSEKLERTSLSYGALAR ITRDGGFWIVLIIRFSAIPTHFSTAVFSTCGVNFWIFAIATFLTLPKQIFLVYLGVLLLQ DKPDDAPKNIVFGIAFVLTIVMAGYIGFKMRFVKKILIEEQEERRKALAMPTMDDTVNTG DGVLDTERSEYEALSQNDFSIAMPGPAAGNHTPLGEPSKGPSTAPSGWTTEAVNTPDSPG TPPNEYFGQQPAKGFQWV Protein Names:Recommended name: Golgi apparatus membrane protein TVP38 Gene Names:Name:TVP38 ORF Names:Pa_5_6980 Expression Region:1-378 Sequence Info:fµLl length protein

1,734.00 € 1734.0 EUR 1,734.00 €

1,734.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.