ELISA Recombinant Yersinia pseudotuberculosis serotype IB Protease HtpX(htpX)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Yersinia pseudotubercµLosis serotype IB (strain PB1/+) Uniprot NO.:B2K6A2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMRIALFLLTNLAVmLVFGLVLSLTGIQSSSVQGLMIMAGLFGFGGAFVSLLMSKWMALR SVGGEVIERPRNETEYWLLETVRRQSQQVGIAMPQVAIYQAPDINAFATGARRDASLVAV STGLLQNMSRDEAEAVIAHEISHVANGDMVTMTLIQGVVNTFVIFISRLIAQIAAGFLSG DRDGESNSPGNPMVYFAVSMVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEAGSMMAFCINGKSKTFSELFMSHPPLDKRIEALRSGQYLK Protein Names:Recommended name: Protease HtpX EC= 3.4.24.- Alternative name(s): Heat shock protein HtpX Gene Names:Name:htpX Ordered Locus Names:YPTS_2450 Expression Region:1-293 Sequence Info:fµLl length protein