Skip to Content

ELISA Recombinant Pyrenophora tritici-repentis Protein get1(get1)

https://www.anagnostics.com/web/image/product.template/151432/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis) Uniprot NO.:B2W1P8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPSLLLVVFILQLLLHIINTVGANTVNELLWVLYNKLPTPTSGSAQRCQVLKQDIVRLKR ELGNTSPQDNFSKWAKLDRQHNKAMAEYQKLDGSLRSHQATFTSAVSTVRWLGTQGLRFV LQFWFSRSPMFWMPAGWVPYYVEWILSFPRAPLGSVSINVWGIACASIISLAAEATAAIW VLVTHKPTPMAAEKQREKQEAMAFSANQKPAEKEL Protein Names:Recommended name: Protein get1 Alternative name(s): Guided entry of tail-anchored proteins 1 Gene Names:Name:get1 ORF Names:PTRG_04383 Expression Region:1-215 Sequence Info:fµLl length protein

1,562.00 € 1562.0 EUR 1,562.00 €

1,562.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.