ELISA Recombinant Podospora anserina Probable endonuclease LCL3(LCL3)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina)
Uniprot NO.:B2AU25
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPWSPGSSSAPSGDKDDIKSKLSSWTKPIRDHLSEGGNWIAPIIAAGATMGFWSFYKTYL RRIPNSAHVSPRYFHRRSLFGKVTSVGDGDGFHLYHTPGGRLAGWGWLRTVPKLKKELKG QTIPIRIAGVDAPEGGHFGRTAQPFAAEAQKFLDSHILNRRVRAYVWRRDQYDRIVATVY VRRPPFFQRKDVSMELLKQGFATTYEAKTGAEFGGPSKEIEYKVAEEVARQKGKGMWSLE KGGGFFHPSKKARAIESPMAYKRRVKLAEEPQRKLDS
Protein Names:Recommended name: Probable endonuclease LCL3 EC= 3.1.-.-
Gene Names:Name:LCL3 ORF Names:Pa_1_17740
Expression Region:1-277
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.