ELISA Recombinant Podospora anserina Signal peptidase complex catalytic subunit SEC11(SEC11)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina) Uniprot NO.:B2B3T2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLSALGNPRQAAAQLMNFGLILSTAFMMWKGLSVISDSPSPIVVVLSGSMEPAFQRGDLL LLWNRNLFTETSVGEVVVYNVRDKDIPIVHRVISKFGTGFVIPRQWWLFMGIYNNDSDDT KLYAPGQNYLVREDIIGRSVVGYMPFVGYVTImLSEHPWMKTVmLGIMGLVVVLQRE Protein Names:Recommended name: Signal peptidase complex catalytic subunit SEC11 EC= 3.4.21.89 Alternative name(s): Signal peptidase I Gene Names:Name:SEC11 ORF Names:CDS Pa_6_7190 Expression Region:1-177 Sequence Info:fµLl length protein