ELISA Recombinant Stenotrophomonas maltophilia UPF0059 membrane protein Smlt4626 (Smlt4626)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Stenotrophomonas maltophilia (strain K279a) Uniprot NO.:B2FNG8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSPISILLIGFAMSTDAFAAAIGKGAAMRRPVFRDALRAGIIFGVIEAITPIIGWLLGRA ALQYVEAFDHWIAFGLLGALGIHMIYNGLRPDSAEEDEDPSQHHGFWKLALTGFATSIDA MAVGIGLAFMDVHIGVMAAVIGLCTLTMVTAGIMFGRVLGSMVGKRAEIIGGVILVIIGA TILYEHLHGVG Protein Names:Recommended name: UPF0059 membrane protein SmLt4626 Gene Names:Ordered Locus Names:SmLt4626 Expression Region:1-191 Sequence Info:fµLl length protein