ELISA Recombinant Sulfurihydrogenibium sp. ATP synthase subunit c(atpE)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:SµLfurihydrogenibium sp. (strain YO3AOP1) Uniprot NO.:B2V9H0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVKFSKVLmLMVLAGTVSAAFAAEGDPMARAVFYGALAIGAGVAIGAAAGGGAAGLGNAI RGVLEGMARNPNMGPKLLTTMFIGMALIETFVLYALLIAIIFIFTGIFDSKAGF Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein Gene Names:Name:atpE Ordered Locus Names:SYO3AOP1_0972 Expression Region:1-114 Sequence Info:fµLl length protein