ELISA Recombinant Proteus mirabilis UPF0208 membrane protein PMI1770 (PMI1770)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Proteus mirabilis (strain HI4320) Uniprot NO.:B4EZD8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNEPTVTPPGFFKKLRLGNEYLKTWPVEKQLAPVFPENRMIKATRFGIRYMPPIAIFTLT WQIALGGDLGPAITTALFACSLPMQGLWWLGKRAATPLPAVLLNWFYEIREKFEQAGIAL APVEKTPTYLSLAHLLKRAFKQLDRSFLDDV Protein Names:Recommended name: UPF0208 membrane protein PMI1770 Gene Names:Ordered Locus Names:PMI1770 Expression Region:1-151 Sequence Info:fµLl length protein