ELISA Recombinant Zea mays CASP-like protein 4

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:B4FAP1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:METPTPRVKPGFNGVGVGMGSSVNGSSRRAGYYMGPAGAVAVAGGGRAAAAAPVDGCSVA LRVFVLAATLVSAVVMGVDRQTSTIRITVTDALPPLEVPLTANWSYSSAFVYFVVANAMV CLFSAAALAACRSRAAMVPVMVGDLLALALLYSAVGAAAEFGILGERGNSHVRWPKVCNV YGRFCERAMAAVIVSLIAAFANLVLLmLNILTIHKSSSYY Protein Names:Recommended name: CASP-like protein 4 Gene Names: Expression Region:1-220 Sequence Info:fµLl length protein