ELISA Recombinant Podospora anserina Protein GET1(GET1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina) Uniprot NO.:B2B0S1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPSLLLIIFVTELVVQLVNTLGATTINDLLWRIYLTLPTPLSLEFAQQRRKQKEYLAVRH ELKATSSQDEFAKWAKLRRQHDKLLEDLEKKKASLEAARTKFDRTLTTTRTVSTRSVQWF LPFWYSKEPMFWLPYGWFPYYVEWFASFPRAPMGSVSIVVWQWACTAVIALMIEAATAAL VYVAAKQSQKIRQPVPAQSEKKDS Protein Names:Recommended name: Protein GET1 Alternative name(s): Guided entry of tail-anchored proteins 1 Gene Names:Name:GET1 ORF Names:Pa_3_7110 Expression Region:1-204 Sequence Info:fµLl length protein