ELISA Recombinant Welwitschia mirabilis Cytochrome b6(petB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Welwitschia mirabilis (Tree tumbo) (Welwitschia bainesii) Uniprot NO.:B2Y1Y9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMVEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVILAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSFSVGQSTL TRFYSLHTFILPFLTAVFmLMHFLMIRKQGISGPL Protein Names:Recommended name: Cytochrome b6 Gene Names:Name:petB Expression Region:1-215 Sequence Info:fµLl length protein