ELISA Recombinant Saccharomyces cerevisiae Stationary phase-expressed protein 1(SPG1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast) Uniprot NO.:B3LI04 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKLDSGIYSEAQRVVRTPKFRYImLGLVGAAVVPTAYMRRGYTVPAHSLDNINGVDTTKA SVMGTEQRAAMTKGKSLQEMMDDDEVTYLMFSSIM Protein Names:Recommended name: Stationary phase-expressed protein 1 Gene Names:Name:SPG1 ORF Names:SCRG_00788 Expression Region:1-95 Sequence Info:fµLl length protein