ELISA Recombinant Yersinia pseudotuberculosis serotype IB Spermidine export protein MdtJ(mdtJ)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yersinia pseudotubercµLosis serotype IB (strain PB1/+) Uniprot NO.:B2K336 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIYWIFLGLAIIAEIIGTLSMKYASVSGEMTGHVVMYFMITGSYVmLSLAVKKVALGVAY ALWEGIGILIITIFSVMWFGETLSPLKIAGLVTLIGGILLVKSGTRKPKQPNRHRGNRPP SVQGLKTQTTGHHKGVAVESGEHHAAA Protein Names:Recommended name: Spermidine export protein MdtJ Gene Names:Name:mdtJ Ordered Locus Names:YPTS_2112 Expression Region:1-147 Sequence Info:fµLl length protein