Skip to Content

ELISA Recombinant Pyrenophora tritici-repentis Formation of crista junctions protein 1(FCJ1)

https://www.anagnostics.com/web/image/product.template/151429/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis) Uniprot NO.:B2WBQ6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ARAARPQWHVAQRFYVDDKKNLGETAVPNPAPTTQPSSSPSNPTPVQENTIPASEVPKGP PAPDSTIGASRDAPTTQPSTTPPTGTGTASVAPDPIKPLPKKKRRRFRRFLLWLTILSGL GYAGGVWYSLVSDNFHDFFTEYIPYGEDAVAYFEEREFRRRFPGRAGEPRLHPQISGENK VTIPGRSGLTARPAKENSSDLASRGPHVSAVDDNKKQDKTESGGQQPKVSSQTPVAKEQP VQATETASSKAITPLDHLNVPSATEPVVQDVVKIVNDIITVVNADNAHDGKYNSALDKAK SELTKVVSDINAMKETLEQQAEAKVKAAHAEFDQAAKELIQRLDHQMQAQETQFKEEFEN ERERLSQSYKERLQSELQAAQKVYEQSLKNRLLEQSIKMQKSFTATVRERVEAEREGRLG KLNELSSSVHELEKLTAEWNSVVDANLKTQHLVVAVEAVKSALETQVVPKPFVTELAALK EIAADDPVVSAAIASINPAAYQRGIPSSALLIDRFRRVAGEVRKAALLPEDAGMASHLAS LAMSKVLFKKSGLAVGADVEAVLARTEVLLEEGDLDAAAREMNGLQGWAKVLSKDWLSEC RRVLEVKQALDVIATEARLNSLLID Protein Names:Recommended name: Formation of crista junctions protein 1 Alternative name(s): Mitofilin Gene Names:Name:FCJ1 ORF Names:PTRG_07069 Expression Region:17-641 Sequence Info:fµLl length protein

1,995.00 € 1995.0 EUR 1,995.00 €

1,995.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.