ELISA Recombinant Thermodesulfovibrio yellowstonii Protein translocase subunit SecF(secF)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:ThermodesµLfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) Uniprot NO.:B5YIG8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIQILGKTNIDFLGKKYIALALSCIMIILGIFAIFQIHAGKANLGVDFAGGLSLQIRFSQ PVTLAEVRTVLDKAGIKDADIQELPTEKKILIKLKKQQEGIQDTIEKALKENLTAKEPII ESVTEIGPKIGERTKRDALFAILAATAGILIYIAIRFKFHFSIGATVATFHDVMAVLGIF YILDKEINLIFISALLTIAGYSLTDTVVVFDRIRENLGKVAKGTMTLEALMNKSINEVLS RTIVTSLTTLMAAVALFFFGGEVLHDFALAMILGILVGTYSSIFVASPVVLLLGKNSLIK R Protein Names:Recommended name: Protein translocase subunit SecF Gene Names:Name:secF Ordered Locus Names:THEYE_A0279 Expression Region:1-301 Sequence Info:fµLl length protein