ELISA Recombinant Rhizobium leguminosarum bv. trifolii UPF0314 protein Rleg2_3744 (Rleg2_3744)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhizobium leguminosarum bv. trifolii (strain WSM2304) Uniprot NO.:B5ZTH0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSAADAEYRVRHQSFWFVACLAVLVAQIVTEYLMGRVPICACGYVKLWEGGVNTSGNSQH LSDWYTPSHIIHGFLFYGLGHLVLRRKPLAAKLLLALFIESGWELLENSPLIIDRYRTAT IALDYYGDSILNSAMDTVFMCLGFFFASRAPVALTVAIAIFFEIFTGYVIRDNLTLNVVM LIWPVEAIKVWQGGV Protein Names:Recommended name: UPF0314 protein Rleg2_3744 Gene Names:Ordered Locus Names:Rleg2_3744 Expression Region:1-195 Sequence Info:fµLl length protein