ELISA Recombinant Schizosaccharomyces japonicus Probable endonuclease lcl3(lcl3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces japonicus (strain yFS275 / FY16936) (Fission yeast) Uniprot NO.:B6JYT1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQNQRNEYSISLRNLSYIILTISTGIVIHRKFRRIKDIEDLSSRFFRGQQKSLTKLNSLY GYVTSVGDGDNFRFYHTPGGRLLGWHWLRKVPSNRNALKNETLSIRLSGIDAPESGYFGK LGQPFSLEAKQFLARKLEHRSVRVYPLHRDQYNRAVCGVTYYPIRWLFFKRDIGPQLVSR GLAVVYEGANSSYYPTEKSVLMKIQETARKRKLGMHSLGNKLELPKDYKKRNK Protein Names:Recommended name: Probable endonuclease lcl3 EC= 3.1.-.- Gene Names:Name:lcl3 ORF Names:SJAG_01749 Expression Region:1-233 Sequence Info:fµLl length protein