ELISA Recombinant Thermodesulfovibrio yellowstonii Cobalamin synthase(cobS)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:ThermodesµLfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) Uniprot NO.:B5YL84 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MINRFLIALSFLTVLPLKFKEINEKELIRSIIFFPFIGFLEGVFCIFLVNIFKQIFSSSV ISIILLVFLFSVRGIFHIDGLSDTFDALFYKGTGQKEKDLQQRLQIMKDSVIGVAGAVAL VLDVLCRFAFVKELIDINQFLIFLFMFCFSRWIVIPLMYYGKPARTTGLGVLFIGKISSW QVIISTVLPIFLLVYFTIEKNFIFLPLIALFLFFISYILKKFFERKFNGITGDHLGATVE ITEIVFLICFLLGEKLWLSY Protein Names:Recommended name: Cobalamin synthase EC= 2.-.-.- Gene Names:Name:cobS Ordered Locus Names:THEYE_A1178 Expression Region:1-260 Sequence Info:fµLl length protein