ELISA Recombinant Rhodospirillum centenum ATP synthase subunit b'(atpG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhodospirillum centenum (strain ATCC 51521 / SW) Uniprot NO.:B6IX46 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTQEVAPPAAAQDDAHGTAEHIAEGVAAETAEHAKGGLPQLNPDTYPTQIFWLAVTFGLL LFLMSKVALPRVAEVLEARQEKIADDLDRAGALKAEADAVIENYERELAEARAKAQKVLS DATLAAESETTQRLGELAADLAERARAAEARIEQARRAALGNIRGVAAETAVAAAAKLAG LDLDPATAEAAVEEALNRVRQEVV Protein Names:Recommended name: ATP synthase subunit b' Alternative name(s): ATP synthase F(0) sector subunit b' ATPase subunit II F-type ATPase subunit b' Short name= F-ATPase subunit b' Gene Names:Name:atpG Synonyms:atpF2 Ordered Locus Names:RC1_3512 Expression Region:1-204 Sequence Info:fµLl length protein