ELISA Recombinant Vibrio fischeri Fumarate reductase subunit C(frdC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vibrio fischeri (strain MJ11) Uniprot NO.:B5FBS7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNRKPYVREMTRTWWKDHPFYRFYMVREATVLPLIFFTICLLVGLGSLVKGPLAWASWL DFMANPIVVALNIVALAGSLFHAQTFFSMMPQVMPIRLGGKTLDKKVVVLAQWAAVAAIT LLVLVIV Protein Names:Recommended name: Fumarate reductase subunit C Gene Names:Name:frdC Ordered Locus Names:VFMJ11_2458 Expression Region:1-127 Sequence Info:fµLl length protein