Skip to Content

ELISA Recombinant Prosthecochloris aestuarii NADH-quinone oxidoreductase subunit A(nuoA)

https://www.anagnostics.com/web/image/product.template/150705/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Prosthecochloris aestuarii (strain DSM 271 / SK 413) Uniprot NO.:B4S751 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDQTLSDFGAVFVFLLLGTVFVVGGYLTARLLRPSRPNPEKLAVYECGEDAVGTSWVKFN IRFYVVALIFIIFDVEVVFLFPWATVFKQLGEFALIEALVFAGILIIGLAYAWVKGDLDW VRPTPNIPSMPQPPQKEK Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1 Gene Names:Name:nuoA Ordered Locus Names:Paes_0842 Expression Region:1-138 Sequence Info:fµLl length protein

1,481.00 € 1481.0 EUR 1,481.00 €

1,481.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.