ELISA Recombinant Rhodospirillum centenum Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhodospirillum centenum (strain ATCC 51521 / SW) Uniprot NO.:B6IWJ6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSMIPRLLRRMAAVLAGLALLLVALAVSYRWVPPPGSPLMAIRLAQGAPGIDRRWVPLDA ISPHLVAAVVASEDSRFCTHHGIDWDAVEAARDHNEAGGRLRGASTLSMQTAKNAFLWPD RTWLRKGAELGFTLLIEATWPKRRIAEVYLNLAEWGDGIFGAEAAARRHFGKPAADLSAQ EAALLAAVLPNPRRWSPERPTAYIRNRAATIERRMAIVRRDGLAACILDPA Protein Names:Recommended name: Monofunctional biosynthetic peptidoglycan transglycosylase Short name= Monofunctional TGase EC= 2.4.2.- Gene Names:Name:mtgA Ordered Locus Names:RC1_3308 Expression Region:1-231 Sequence Info:fµLl length protein