ELISA Recombinant Thermococcus onnurineus UPF0290 protein TON_1624 (TON_1624)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Thermococcus onnurineus (strain NA1) Uniprot NO.:B6YUC9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLSSLLWAFWYILPAYFANASPVLVGGGRPIDGGRYWKDGRRVFGDGKTWRGLIGGVAI GTAVGALQYFITPEFYGSLGKALLLAFLLSFGALFGDLVGSFFKRRIDLPRGSPAIGLDQ LGFLISALAFAYPVKTLDSGQIIFLLVVSPFVHWGANYFAYKMGWKSVPW Protein Names:Recommended name: UPF0290 protein TON_1624 Gene Names:Ordered Locus Names:TON_1624 Expression Region:1-170 Sequence Info:fµLl length protein