ELISA Recombinant Prosthecochloris aestuarii ATP synthase subunit a 2(atpB2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Prosthecochloris aestuarii (strain DSM 271 / SK 413) Uniprot NO.:B4S6E6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AEAPAEAVHAEAAAHAEGGHESAGDVIMHHILDTGVMSFEPFGEVHLPQIVIGGFDISIT RHVVMMWIASAILLVVFLLVGNRYKTMTSRQAPGGMANAMEALVEFIRLDVAKSNIGAGY EKHLPYLLTVFAFILLLNLLGLVPYGATATGNINVTLTLAVFTFFITQVASLKAHGIKGY LAHLTAGTHWALWIIMIPIEIIGLFTKPFALTVRLFANMTAGHIVILSLIFISFILKSYI VAMFVSVPFSIFIYLLEIFVAFLQAFIFTmLSALFIGLATAHEGHEGEAAH Protein Names:Recommended name: ATP synthase subunit a 2 Alternative name(s): ATP synthase F0 sector subunit a 2 F-ATPase subunit 6 2 Gene Names:Name:atpB2 Ordered Locus Names:Paes_2247 Expression Region:34-324 Sequence Info:fµLl length protein