ELISA Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 34, mitochondrial(AIM34)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast)
Uniprot NO.:B5VPC6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:HLSFLMNNNDITPFQKFTVKVLKEQCKSRGLKLSGRKSDLLQRLITHDSCSNKKSSVKIN EPKKKRILINDPIKITKKLVSDKTFRTIEKNISSLQNTPVIETPCDVHSHLQPRDRIFLL GFFmLSCLWWNLEPQESKPTIDH
Protein Names:Recommended name: Altered inheritance of mitochondria protein 34, mitochondrial
Gene Names:Name:AIM34 ORF Names:AWRI1631_131390
Expression Region:56-198
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.