ELISA Recombinant Vibrio fischeri UPF0208 membrane protein VFMJ11_0876 (VFMJ11_0876)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vibrio fischeri (strain MJ11) Uniprot NO.:B5FC41 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSENGFLFRFRDGQTYMDTWPERKELAPMFPEQRVIKATKFAVKVMPAVAVISVLTQMVF NNTAGLPQAIIIALFAISMPLQGFWWLGNRANTKLPPALASWYRELYQKIIESGAALEPM KSQPRYKELANILNKAFKQLDKTALERWF Protein Names:Recommended name: UPF0208 membrane protein VFMJ11_0876 Gene Names:Ordered Locus Names:VFMJ11_0876 Expression Region:1-149 Sequence Info:fµLl length protein