ELISA Recombinant Vibrio fischeri UPF0397 protein VFMJ11_1662 (VFMJ11_1662)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vibrio fischeri (strain MJ11) Uniprot NO.:B5FEZ3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNLSAKTVVVIAIGAALYGIGGLPMFGIPVFANTTLKPAMAVLALFSVLYGPIVGFLVGF IGHWVTDLFAGWGVWLTWVLGSGIVGMIIGLFPIITKNRIESGLFDKKDFLIFVVLAFFG NVFGYGTSAFLDTILYAEPFTKVFMQLCIIAAGNTFLIAIVGYFILNNLAKRKKQSTNLT EAP Protein Names:Recommended name: UPF0397 protein VFMJ11_1662 Gene Names:Ordered Locus Names:VFMJ11_1662 Expression Region:1-183 Sequence Info:fµLl length protein