ELISA Recombinant Zea mays Cell number regulator 2(CNR2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:B6TYV8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MYPKAADEGAQPLATGIPFSGGGGYYQAGGAMAAAFAVQAQAPVAAWSTGLCNCFDDCHN CCVTCVCPCITFGQTAEIIDRGSTSCGTSGALYALVmLLTGCQCVYSCFYRAKMRAQYGL QVSPCSDCCVHCCCQCCALCQEYRELKKRGFDMSIGWHANMERQGRAAAAVPPHMHPGMT R Protein Names:Recommended name: Cell number regµLator 2 Alternative name(s): ZmCNR02 Gene Names:Name:CNR2 Expression Region:1-181 Sequence Info:fµLl length protein