ELISA Recombinant Pseudomonas aeruginosa UPF0114 protein PLES_49571 (PLES_49571)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas aerµginosa (strain LESB58) Uniprot NO.:B7V0B7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MERFFENAMYASRWLLAPIYMGLSLALLALTIKFFQEIFHVIPNIFAMAEADLILVLLSL IDMALVGGLLVMVMISGYENFVSQLDIDEGKEKLSWLGKMDSGSLKNKVAASIVAISSIH LLRIFMDAKNVPDNKLMWYVIIHMTFVLSAFAMGYLDKQTRH Protein Names:Recommended name: UPF0114 protein PLES_49571 Gene Names:Ordered Locus Names:PLES_49571 Expression Region:1-162 Sequence Info:fµLl length protein