ELISA Recombinant Pseudomonas aeruginosa Protein CysZ homolog(cysZ)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas aerµginosa (strain LESB58) Uniprot NO.:B7UY90 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPALSGPQYLGEGLKLIMRPGLRLFVLIPLTLNLLVFALLIGFAMQQFSHWVDLLMPSLP DWLSFLQYIVWPLFVLLVLVIVFFTFTMVANIISAPFNGFLSEKVEVVVRGRDDFPPFSW AELLAMIPRTMGREMRKLAYFLPRALVLLVLSFVPGVNLIATPLWILFGIWMMAVQYIDY PADNHKLGWNEmLAWLRSKRWACMGFGGVTYLALLIPLVNLVMMPAAVAGATLFWVREEG EKALVK Protein Names:Recommended name: Protein CysZ homolog Gene Names:Name:cysZ Ordered Locus Names:PLES_44721 Expression Region:1-246 Sequence Info:fµLl length protein