ELISA Recombinant Pseudomonas aeruginosa UPF0059 membrane protein PLES_21541 (PLES_21541)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas aerµginosa (strain LESB58) Uniprot NO.:B7V6V8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNPVSLIFLAFAMSTDAFAAAIGKGSSLDRPRLSEALRTGIIFGVIEAITPLVGWLLGQA ASQFVADWDHWIAFVLLVLLGLHMIHNGLRADHETEQEKPGQHSFWILAVTALATSIDAL AVGVGLAFVDVNIFLAAGAIGLATMTMVTLGTmLGRALGAVTGKRAEMVGGVVLILVGAT ILYEHLSAA Protein Names:Recommended name: UPF0059 membrane protein PLES_21541 Gene Names:Ordered Locus Names:PLES_21541 Expression Region:1-189 Sequence Info:fµLl length protein